Tribaldex Blog

Daily Blog: An Ice Cream at Night

@vinzie172
Actifit

I didn't think that today will be a tiring day for me because of the things that I did like walking in the middle of the day while searching for the best food that I could eat for my lunch and at the same time, doing my daily activity.

Also, I didn't get sleep in the afternoon and I think I need to rest now because my boss requested me to have a work today even if today is a scheduled rest day for me because I needed an extra money for other stuffs.

At night, I am really craving for an ice cream because I want to taste an ice cream not just tonight but the other days, too. So, I told my brother to buy an ice cream for us. He didn't hesitate to go to the store and buy it and this is a homemade ice cream that I think is more cheaper than other leading brands. There were also two flavors that I requested to buy, one of which is the Durian ice cream and the other one is the cookies & cream. I like the durian than the cookies & cream but my other siblings like cookies & cream.

We enjoyed the night full of ice cream in our mouth and we were also full because we paired the ice cream with the sandwich.

Note: The first photo was edited by myself using my Incollage application on my phone

Divider_Hive_black_red.png

Banner_V.gif

Divider_Hive_black_red.png
This report was published via Actifit app (Android | iOS). Check out the original version here on actifit.io


29/07/2024
5318
Daily Activity

hive-193552actifitphilippinesneoxianhive-enginetribespepearchonalivealiveandthrivingvybproofofbrainpobwaiviobrkcentpimpweedthgaminglassecashmemefunoneuphivelistcreativecoincccctppalnetphotographysportstalkmovetoearnmove2earn
9.82177284 BEE
3 comments
@holovision.cash58

!MEME

0E-8 BEE
@actifit74

Congrats on providing Proof of Activity via your Actifit report!

You have been rewarded 349.3754 AFIT tokens for your effort in reaching 5318 activity, as well as your user rank and report quality!
You also received a 26.11% upvote via @actifit account. 25.00% of this upvote value is a result of an exchange transaction you performed for 200 AFIT tokens !

The following splinterland boosts were applied to your post:
  • 12 Common Cards Boost: +5 AFIT
    The following boosts were applied to your post:
    Rank Bag - L2
    + 10 % User Rank
    Rank Bag - L4
    + 11 % User Rank
    Rank Bag - L5
    + 13 % User Rank
    Sports Hat - L5
    + 18 % AFIT
    Protein Shake - L3
    + 15 % AFIT
    Protein Shake - L4
    + 16 % AFIT
    Protein Shake - L2
    + 15 % AFIT
    Sports Hat - L4
    + 16 % AFIT
    Sunglasses - L1
    + 15 % AFIT
    + 1 % SPORTS
    Sports Hat - L1
    + 15 % AFIT
    Protein Shake - L1
    + 15 % AFIT
    Sunglasses - L2
    + 15 % AFIT
    + 1.5 % SPORTS
    Sports Hat - L2
    + 15 % AFIT
    Sunglasses - L3
    + 15 % AFIT
    + 2 % SPORTS
    Sunglasses - L4
    + 15 % AFIT
    + 2.5 % SPORTS
    Friend Boost - L4
    + 16 % AFIT
    + 12 % AFIT
    Sunglasses - L5
    + 17 % AFIT
    + 3 % SPORTS
    Friend Boost - L5
    + 18 % AFIT
    + 14 % AFIT
    Friend Boost - L5
    + 18 % AFIT
    Thanks to your friend @manuvert
    + 14 % AFIT
    Thanks to your friend @manuvert
    Water Bottle - L3
    + 20 AFIT
    ... and 14 other gadgets.
    Boosts increased your AFIT earnings by 303.9779 AFIT
    AFIT rewards and upvotes are based on your: - User rank: which depends on your delegated SP, accumulated AFIT tokens, rewarded post count, recent rewarded activity and owned AFITX. - Post score: which depends on your activity count, post content, post upvotes, quality comments, moderator review and user rank.

    To improve your user rank, delegate more, pile up more AFIT and AFITX tokens, and post more.
    To improve your post score, get to the max activity count, work on improving your post content, improve your user rank, engage with the community to get more upvotes and quality comments.

    • 0E-8 BEE