Tribaldex Blog

Il mio Report Actifit: Settembre 20 2023

@gidien54
Actifit


THE WORLD NEAR ME (Jiashan)

because the world is what you can see with your eyes

Hello everyone,

I did all of today's steps at the airport. most of them at Hong Kong airport and some at Shianga airport. I returned to Jiashan.


Hong Kong airport

Today there were many people in Shanghai. I was in a hurry to get back.

seeing so many of those people who didn't know what to do took me back to the first times that I was like them too.

now I know very well what to do.

the first step is to scan a code with we chat, fill in the form with your personal and flight data and obtain a qr code to show at the first checkpoint.

then, before arriving at passport control and visa to get the entry stamp, you must fill out a paper form.

here I went to the table and placed the bag with what I had bought at duty free.

I was writing when a girl near me asked me for help.

I was in a hurry and didn't want to waste time. Inside I thought, oh no, but then I thought about how many times I asked for help.

I helped her, filled out mine and ran to passport control.

I was in the crowd waiting when someone called me. it was the girl who gave me the bag I had forgotten.

in that moment I had proof of what I think, a better world is possible.

kindness begets more kindness. I stopped thinking. I stopped being in a hurry.

In this chaos called life, fate decides who should meet and who should not meet.

I am alive and I am still here

We believe, we love, we are alive...

-Gidien-
This report was published via Actifit app (Android | iOS). Check out the original version here on actifit.io


20/09/2023
11680
Camminare
Height
190 cm
Weight
93 kg
Body Fat
%
Waist
cm
Thighs
cm
Chest
cm

hive-193552actifitaliveiamalivechallengehive-enginepalnetwaivneoxiancreativecoinaliveandthrivingbilpcoinblogtokenhustlerocdcccproofofbrainpimpvybcentarchonctpashlassecashteamukhiveposhtravelsportstalkmovetoearnmove2earn
0.17723996 BEE
3 comments
@teamuksupport59

Hi @gidien,
Thank you for participating in the #teamuk curated tag. We have upvoted your quality content.
For more information visit our discord https://discord.gg/8CVx2Am

0.00001033 BEE
@hivebuzz74

Congratulations @gidien! You have completed the following achievement on the Hive blockchain And have been rewarded with New badge(s)

You received more than 6000 upvotes.
Your next target is to reach 7000 upvotes.

You can view your badges on your board and compare yourself to others in the Ranking
If you no longer want to receive notifications, reply to this comment with the word STOP

0E-8 BEE
@actifit74

Congrats on providing Proof of Activity via your Actifit report!

You have been rewarded 456.6397 AFIT tokens for your effort in reaching 11680 activity, as well as your user rank and report quality!
You also received a 2.34% upvote via @actifit account.

The following boosts were applied to your post:
Rank Bag - L3
+ 10 % User Rank
Rank Bag - L4
+ 11 % User Rank
Rank Bag - L1
+ 10 % User Rank
Ranker Tree - L1
+ 15 User Rank
Sports Hat - L1
+ 15 % AFIT
Sunglasses - L2
+ 15 % AFIT
+ 1.5 % SPORTS
Sunglasses - L1
+ 15 % AFIT
+ 1 % SPORTS
Protein Shake - L3
+ 15 % AFIT
Protein Shake - L1
+ 15 % AFIT
Sports Hat - L4
+ 16 % AFIT
Sports Hat - L5
+ 18 % AFIT
Sports Hat - L2
+ 15 % AFIT
Protein Shake - L2
+ 15 % AFIT
Sunglasses - L3
+ 15 % AFIT
+ 2 % SPORTS
Sports Hat - L3
+ 15 % AFIT
Double Raindeer - L1
+ 100 % AFIT
Running Shoes - L1
+ 10 AFIT
Water Bottle - L3
+ 20 AFIT
Running Shoes - L3
+ 20 AFIT
Water Bottle - L4
+ 35 AFIT
... and 14 other gadgets.
Boosts increased your AFIT earnings by 391.1547 AFIT
AFIT rewards and upvotes are based on your: - User rank: which depends on your delegated SP, accumulated AFIT tokens, rewarded post count, recent rewarded activity and owned AFITX. - Post score: which depends on your activity count, post content, post upvotes, quality comments, moderator review and user rank.

To improve your user rank, delegate more, pile up more AFIT and AFITX tokens, and post more.
To improve your post score, get to the max activity count, work on improving your post content, improve your user rank, engage with the community to get more upvotes and quality comments.

0E-8 BEE