Tribaldex Blog

Il mio Report Actifit: Settembre 19 2023

@gidien54
Actifit


THE WORLD NEAR ME (Hong Kong)

because the world is what you can see with your eyes

Hello everyone

Today I went to Hong Kong to renew my visa. I like flying and I like clouds.

I usually always refused the window seat. I'm tall and traveling in economy hobpico space.

I like to stretch my legs in the corridor. but once I tried, I wanted to make a video.

Since then I just want the window seat and look out.

sometimes it happens to be close to the wing.

the last time I arrived late and ended up in the queue.

today I didn't have a window but a couple offered me an exchange for a seat at the head of the window.

uncomfortable journey because I had the wall in front of me and I couldn't stretch out my feet.

but the view was stunning. Shiangai - Hong Kong 2 and a half hours.

other downside, my luggage from seat 1x was left in seat 11.

I had to fight to pick it up.

For today is all,

I am alive and I am still here

-Gidien-


This report was published via Actifit app (Android | iOS). Check out the original version here on actifit.io


19/09/2023
8828
Camminare
Height
190 cm
Weight
93 kg
Body Fat
%
Waist
cm
Thighs
cm
Chest
cm

hive-193552actifitaliveiamalivechallengehive-enginelassecashpimpvybneoxianviweccchivetravelsportstalkmovetoearnmove2earn
0.11303686 BEE
1 comments
@actifit74

Congrats on providing Proof of Activity via your Actifit report!

You have been rewarded 417.0829 AFIT tokens for your effort in reaching 8828 activity, as well as your user rank and report quality!
You also received a 2.08% upvote via @actifit account.

The following boosts were applied to your post:
Rank Bag - L2
+ 10 % User Rank
Rank Bag - L1
+ 10 % User Rank
Rank Bag - L3
+ 10 % User Rank
Rank Bag - L4
+ 11 % User Rank
Ranker Tree - L1
+ 15 User Rank
Sports Hat - L1
+ 15 % AFIT
Sunglasses - L2
+ 15 % AFIT
+ 1.5 % SPORTS
Sunglasses - L1
+ 15 % AFIT
+ 1 % SPORTS
Protein Shake - L3
+ 15 % AFIT
Protein Shake - L1
+ 15 % AFIT
Double Raindeer - L1
+ 100 % AFIT
Sports Hat - L4
+ 16 % AFIT
Sports Hat - L5
+ 18 % AFIT
Sports Hat - L2
+ 15 % AFIT
Protein Shake - L2
+ 15 % AFIT
Sunglasses - L3
+ 15 % AFIT
+ 2 % SPORTS
Sports Hat - L3
+ 15 % AFIT
Water Bottle - L1
+ 5 AFIT
Running Shoes - L1
+ 10 AFIT
Water Bottle - L3
+ 20 AFIT
... and 16 other gadgets.
Boosts increased your AFIT earnings by 362.3179 AFIT
AFIT rewards and upvotes are based on your: - User rank: which depends on your delegated SP, accumulated AFIT tokens, rewarded post count, recent rewarded activity and owned AFITX. - Post score: which depends on your activity count, post content, post upvotes, quality comments, moderator review and user rank.

To improve your user rank, delegate more, pile up more AFIT and AFITX tokens, and post more.
To improve your post score, get to the max activity count, work on improving your post content, improve your user rank, engage with the community to get more upvotes and quality comments.

Actifit shared its growth plans for 2023 with focus on hive services and integrations. Please vote now for our DHF proposal in support:
Vote on peakd
Vote on ecency
Vote on Hive wallet
Vote via hivesigner

rulersig2.jpg
Chat with us on discord | Visit our website
Follow us on Twitter | Join us on Telegram
Download on playstore | Download on app store

Knowledge base:
FAQs | Whitepaper
How to signup | Maximize your rewards
Complete Actifit Tutorial
rulersig2.jpg
Actifit supports cross-chain decentralization. Support our efforts below by voting for:

0E-8 BEE